PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG327400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 244aa    MW: 28241.2 Da    PI: 8.7096
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG327400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81e-31959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Pavir.6NG327400.1.p  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                         79***********************************************96 PP

2K-box98.69e-33841768100
                K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                          + e+++ +s+++e+ kLk+++enLqr+qR+llGedL++L++keL++Le+qL++slk+iRs++++++++q+ elq++ek+ +e nk+Lr+k
  Pavir.6NG327400.1.p  84 NRESEQLKSSRNEYLKLKARVENLQRTQRNLLGEDLDTLDIKELEHLEKQLDSSLKHIRSTRTQHMVDQLTELQRREKMFSESNKCLRRK 173
                          4678899*********************************************************************************** PP

                K-box  98 lee 100
                          lee
  Pavir.6NG327400.1.p 174 LEE 176
                          987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.389161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
CDDcd002657.61E-45277No hitNo description
SuperFamilySSF554555.76E-34290IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-333859IPR002100Transcription factor, MADS-box
PfamPF014867.2E-2586174IPR002487Transcription factor, K-box
PROSITE profilePS5129715.06590180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
QSMPKTLEKY QKCSYAGPET ALQNRESEQL KSSRNEYLKL KARVENLQRT QRNLLGEDLD  120
TLDIKELEHL EKQLDSSLKH IRSTRTQHMV DQLTELQRRE KMFSESNKCL RRKLEESDQV  180
IWQQAWENGE PQPEVQHQLH GGNGFFHPLD AARGEPTLQI GYPSEAQLPS SCMTTLFLPP  240
WLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-30751761103Developmental protein SEPALLATA 3
4ox0_B3e-30751761103Developmental protein SEPALLATA 3
4ox0_C3e-30751761103Developmental protein SEPALLATA 3
4ox0_D3e-30751761103Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974003.11e-158PREDICTED: MADS-box transcription factor 7-like
SwissprotP0C5B01e-149MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4661e-149MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLC5YHS61e-151C5YHS6_SORBI; Putative uncharacterized protein Sb07g026200
TrEMBLK3YI681e-151K3YI68_SETIT; Uncharacterized protein
STRINGSi013937m1e-151(Setaria italica)
STRINGSb07g026200.11e-151(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34833469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.15e-92MIKC_MADS family protein